2.50 Rating by CuteStat

neoshosd.org is 7 years 11 months old. It is a domain having org extension. It has a global traffic rank of #6576752 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, neoshosd.org is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 128
Daily Pageviews: 256

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 3,230
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 3,950
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 6,576,752
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

52.206.191.232

Hosted Country:

United States of America US

Location Latitude:

39.0469

Location Longitude:

-77.4903
Neosho School District / Homepage

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 20 H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 8
Google Adsense: Not Applicable Google Analytics: UA-5173826-6

Websites Hosted on Same IP (i.e. 52.206.191.232)

Anne Arundel County Public Schools / Homepage

- aacps.org
162,213 $ 73,800.00

Community Unit School District 200 / Overview

- cusd200.org
135,148 $ 88,800.00

Hollidaysburg Area School District / Overview

- tigerwires.com

Hollidaysburg Area School District Information and Happenings.

866,392 $ 1,440.00

Broward County Public Schools / Homepage

- browardschools.com
24,372 $ 596,880.00

Blackboard Web Community Manager | Blackboard.com

- schoolwires.com

Blackboard Web Community Manager is the online presence your district needs in order to stand out to your community and families. Web Community Manager allows parents to play an active role in their child’s success with a dashboard full of personalized student data and gives community members the chance to engage with

1,275,789 $ 960.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 14 Dec 2019 00:02:30 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 56810
Connection: keep-alive
Cache-Control: private
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
Strict-Transport-Security: max-age=31536000; includeSubDomains;
X-XSS-Protection: 1; mode=block
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
X-Frame-Options: SAMEORIGIN

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: May 20, 2016, 1:14 AM 7 years 11 months 3 days ago
Expiration Date: May 20, 2026, 1:14 AM 2 years 2 weeks 1 day from now
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
ns21.domaincontrol.com 97.74.100.11 United States of America United States of America
ns22.domaincontrol.com 173.201.68.11 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
neoshosd.org A 599 IP: 52.206.191.232
neoshosd.org NS 3600 Target: ns21.domaincontrol.com
neoshosd.org NS 3600 Target: ns22.domaincontrol.com
neoshosd.org SOA 600 MNAME: ns21.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2019070100
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 600
neoshosd.org MX 604800 Priority: 20
Target: alt1.aspmx.l.google.com
neoshosd.org MX 604800 Priority: 30
Target: alt2.aspmx.l.google.com
neoshosd.org MX 604800 Priority: 40
Target: aspmx2.googlemail.com
neoshosd.org MX 604800 Priority: 50
Target: aspmx3.googlemail.com
neoshosd.org MX 604800 Priority: 10
Target: aspmx.l.google.com
neoshosd.org TXT 3600 TXT: v=spf1 include:_spf.google.com
include:_spf.bbnotify.net ~all
neoshosd.org TXT 3600 TXT: google-site-verification=tcKUJWVZ4Ljv7dW
ocppPyTwnZyUprMWoPR-zmBGqN0s

Similarly Ranked Websites

Swept Away Media: Swept Away TV and The Rock Star Stories

- sweptawaytv.com

Youth not for profit media marketing, social media marketing, video production and promotion located in Boynton Beach FL. working with students worldwide.

6,576,767 $ 240.00

BNN1-1(2)

- pegahchat.com
6,576,771 $ 240.00

Risperdal Tardive Dyskinesia Lawsuit | Risperdal Lawsuits

- risperdaltardivedyskinesialawsuit.com

Lawsuit information for individuals who have experienced tardive dyskinesia as a result of using Risperdal. Learn more and find out how to get help.

6,576,774 $ 8.95

newDemocracy Foundation

- newdemocracy.com.au

newDemocracy is a not-for-profit research group, with a particular focus on best-practice citizen engagement and innovations in democratic structures.

6,576,776 $ 240.00

Host Europe GmbH – winace.com

- winace.com
6,576,789 $ 240.00

Full WHOIS Lookup

Domain Name: neoshosd.org
Registry Domain ID: D188701220-LROR
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2016-05-19T19:29:29Z
Creation Date: 2016-05-19T19:29:29Z
Registrar Registration Expiration Date: 2026-05-19T19:29:29Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: Neosho R5 Schools
Registrant State/Province: Missouri
Registrant Country: US
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=neoshosd.org
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=neoshosd.org
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=neoshosd.org
Name Server: NS21.DOMAINCONTROL.COM
Name Server: NS22.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-14T00:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Notes:

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.